biopython-molecular-biology
GitHub提供计算分子生物学工具包,支持序列操作、生物文件格式解析与转换、NCBI数据库查询、BLAST搜索及蛋白质结构分析。适用于批量处理、自定义流水线构建和基因数据获取等科研场景。
触发场景
安装
npx skills add jaechang-hits/SciAgent-Skills --skill biopython-molecular-biology -g -y
SKILL.md
Frontmatter
{
"name": "biopython-molecular-biology",
"license": "Biopython License (BSD-like)",
"description": "Molecular biology toolkit: sequence manipulation, FASTA\/GenBank\/PDB I\/O, NCBI Entrez, BLAST automation, pairwise\/MSA alignment, Bio.PDB, phylogenetic trees. Use for batch processing, custom pipelines, format conversion, PubMed\/GenBank queries. For quick gene lookups use gget; for multi-service REST APIs use bioservices."
}
Biopython: Computational Molecular Biology Toolkit
Overview
Biopython is the standard open-source Python library for computational molecular biology, providing modular APIs for sequence handling, biological file parsing, NCBI database access, BLAST searches, protein structure analysis, and phylogenetics. It supports Python 3 and requires NumPy.
When to Use
- Parse and convert biological file formats (FASTA, GenBank, FASTQ, PDB, mmCIF, PHYLIP)
- Fetch sequences or publications from NCBI databases (GenBank, PubMed, Protein) programmatically
- Run and parse BLAST searches (remote NCBI or local BLAST+)
- Perform pairwise or multiple sequence alignments with custom scoring
- Analyze 3D protein structures — distances, angles, DSSP, superimposition
- Build and visualize phylogenetic trees from sequence alignments
- Calculate sequence statistics (GC content, molecular weight, melting temperature)
- Batch-process thousands of sequences with custom filtering logic
- Use
pysaminstead for reading SAM/BAM/CRAM alignment files and working with mapped reads; usescikit-bioinstead for advanced ecological diversity metrics
Prerequisites
- Python packages:
biopython,numpy,matplotlib(for tree visualization) - Data requirements: Sequence files (FASTA, GenBank, FASTQ) or accession IDs for NCBI access
- Environment: Python 3.8+; NCBI Entrez requires email registration
pip install biopython numpy matplotlib
Quick Start
from Bio import SeqIO
from Bio.Seq import Seq
from Bio.SeqUtils import gc_fraction
# Parse a FASTA file and compute basic statistics
records = list(SeqIO.parse("sequences.fasta", "fasta"))
print(f"Sequences loaded: {len(records)}")
seq = records[0].seq
print(f"ID: {records[0].id}")
print(f"Length: {len(seq)} bp")
print(f"GC content: {gc_fraction(seq)*100:.1f}%")
print(f"Reverse complement: {seq.reverse_complement()[:30]}...")
print(f"Protein translation: {seq.translate()[:10]}...")
Core API
Module 1: Sequence Objects (Bio.Seq)
Create and manipulate DNA, RNA, and protein sequences.
from Bio.Seq import Seq
# Create sequence and perform standard operations
dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG")
print(f"Length: {len(dna)} bp")
print(f"Complement: {dna.complement()}")
print(f"Reverse complement: {dna.reverse_complement()}")
print(f"Transcription: {dna.transcribe()}")
print(f"Translation: {dna.translate()}")
print(f"Translation (to stop): {dna.translate(to_stop=True)}")
# Length: 39 bp
# Translation: MAIVMGR*KGAR*
# Translation (to stop): MAIVMGR
from Bio.Seq import Seq
# Alternative genetic codes (e.g., mitochondrial)
mito_dna = Seq("ATGGCCATTGTAATGGGCCGCTGA")
std_protein = mito_dna.translate(table=1) # Standard
mito_protein = mito_dna.translate(table=2) # Vertebrate mitochondrial
print(f"Standard: {std_protein}")
print(f"Mitochondrial: {mito_protein}")
# Find all start codons
coding_dna = Seq("ATGAAACCCATGGGGTTTAAATAG")
positions = [i for i in range(len(coding_dna) - 2) if coding_dna[i:i+3] == "ATG"]
print(f"ATG positions: {positions}")
# ATG positions: [0, 9]
Module 2: Sequence I/O (Bio.SeqIO)
Read, write, and convert biological file formats.
from Bio import SeqIO
# Parse FASTA file — returns SeqRecord iterator
records = list(SeqIO.parse("sequences.fasta", "fasta"))
print(f"Loaded {len(records)} sequences")
for rec in records[:3]:
print(f" {rec.id}: {len(rec.seq)} bp — {rec.description}")
# Parse GenBank — rich annotation access
for rec in SeqIO.parse("genome.gb", "genbank"):
print(f"{rec.id}: {len(rec.features)} features, {len(rec.seq)} bp")
for feat in rec.features[:5]:
print(f" {feat.type}: {feat.location}")
# Convert between formats
count = SeqIO.convert("input.gb", "genbank", "output.fasta", "fasta")
print(f"Converted {count} records: GenBank → FASTA")
from Bio import SeqIO
from Bio.SeqRecord import SeqRecord
from Bio.Seq import Seq
# Write sequences to file
records = [
SeqRecord(Seq("ATCGATCG"), id="seq1", description="test sequence 1"),
SeqRecord(Seq("GCTAGCTA"), id="seq2", description="test sequence 2"),
]
count = SeqIO.write(records, "output.fasta", "fasta")
print(f"Wrote {count} records to output.fasta")
# Filter sequences by length (streaming — memory efficient)
long_seqs = (rec for rec in SeqIO.parse("large_file.fasta", "fasta") if len(rec.seq) >= 200)
count = SeqIO.write(long_seqs, "filtered.fasta", "fasta")
print(f"Kept {count} sequences >= 200 bp")
# Index large FASTA for random access
idx = SeqIO.index("large_file.fasta", "fasta")
print(f"Indexed {len(idx)} sequences")
rec = idx["target_sequence_id"]
print(f"Retrieved: {rec.id}, {len(rec.seq)} bp")
Module 3: NCBI Database Access (Bio.Entrez)
Programmatic search and download from NCBI databases.
from Bio import Entrez, SeqIO
Entrez.email = "your.email@example.com"
# Entrez.api_key = "your_key" # Optional: 10 req/s instead of 3 req/s
# Search PubMed
handle = Entrez.esearch(db="pubmed", term="CRISPR Cas9 2024", retmax=5)
results = Entrez.read(handle)
handle.close()
print(f"Found {results['Count']} articles, retrieved {len(results['IdList'])} IDs")
print(f"IDs: {results['IdList']}")
# Fetch GenBank record by accession
handle = Entrez.efetch(db="nucleotide", id="EU490707", rettype="gb", retmode="text")
record = SeqIO.read(handle, "genbank")
handle.close()
print(f"{record.id}: {record.description}")
print(f"Length: {len(record.seq)} bp, Features: {len(record.features)}")
from Bio import Entrez
import time
Entrez.email = "your.email@example.com"
# Batch download with rate limiting
handle = Entrez.esearch(db="protein", term="insulin[Protein Name] AND human[Organism]", retmax=20)
results = Entrez.read(handle)
handle.close()
# Fetch summaries in batch
ids = results["IdList"][:10]
handle = Entrez.esummary(db="protein", id=",".join(ids))
summaries = Entrez.read(handle)
handle.close()
for doc in summaries:
print(f" {doc['AccessionVersion']}: {doc['Title'][:60]}...")
print(f"\nFetched {len(summaries)} protein summaries")
Module 4: BLAST Operations (Bio.Blast)
Run and parse BLAST searches against NCBI or local databases.
from Bio.Blast import NCBIWWW, NCBIXML
# Remote BLAST search (nucleotide)
query_seq = "ATCGATCGATCGATCGATCGATCGATCGATCG"
result_handle = NCBIWWW.qblast("blastn", "nt", query_seq, hitlist_size=5)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
print(f"Query: {blast_record.query[:50]}")
print(f"Database: {blast_record.database}")
print(f"Hits: {len(blast_record.alignments)}")
for aln in blast_record.alignments[:3]:
hsp = aln.hsps[0]
print(f"\n {aln.title[:60]}...")
print(f" E-value: {hsp.expect:.2e}, Identity: {hsp.identities}/{hsp.align_length}")
print(f" Score: {hsp.score}, Bits: {hsp.bits:.1f}")
from Bio.Blast.Applications import NcbiblastpCommandline
from Bio.Blast import NCBIXML
# Local BLAST (requires BLAST+ installed)
blastp_cline = NcbiblastpCommandline(
query="query.fasta",
db="swissprot",
evalue=1e-5,
outfmt=5, # XML output
out="blast_results.xml",
num_threads=4,
)
print(f"Command: {blastp_cline}")
# stdout, stderr = blastp_cline() # Execute
# Parse local BLAST XML results
with open("blast_results.xml") as f:
for record in NCBIXML.parse(f):
print(f"Query: {record.query}")
for aln in record.alignments[:3]:
print(f" Hit: {aln.hit_def[:50]}, E={aln.hsps[0].expect:.2e}")
Module 5: Pairwise Alignment (Bio.Align)
Global and local pairwise sequence alignment with customizable scoring.
from Bio import Align
# Global alignment
aligner = Align.PairwiseAligner()
aligner.mode = "global"
aligner.match_score = 2
aligner.mismatch_score = -1
aligner.open_gap_score = -5
aligner.extend_gap_score = -0.5
alignments = aligner.align("ACCGGTAACG", "ACGGTAAC")
print(f"Score: {alignments.score}")
print(f"Number of alignments: {len(alignments)}")
print(f"Best alignment:\n{alignments[0]}")
from Bio import Align
from Bio.Align import substitution_matrices
# Protein alignment with BLOSUM62
aligner = Align.PairwiseAligner()
aligner.mode = "local"
aligner.substitution_matrix = substitution_matrices.load("BLOSUM62")
aligner.open_gap_score = -10
aligner.extend_gap_score = -0.5
seq1 = "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
seq2 = "MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST"
alignments = aligner.align(seq1, seq2)
print(f"Score: {alignments.score}")
print(f"Best alignment:\n{alignments[0]}")
Module 6: Protein Structure Analysis (Bio.PDB)
Parse PDB/mmCIF files and analyze 3D protein structures.
from Bio.PDB import PDBParser, PPBuilder
# Parse PDB structure
parser = PDBParser(QUIET=True)
structure = parser.get_structure("1CRN", "1crn.pdb")
# Navigate SMCRA hierarchy: Structure > Model > Chain > Residue > Atom
model = structure[0]
for chain in model:
residues = list(chain.get_residues())
print(f"Chain {chain.id}: {len(residues)} residues")
# Extract sequence from structure
ppb = PPBuilder()
for pp in ppb.build_peptides(structure):
print(f"Peptide: {pp.get_sequence()[:50]}... ({len(pp.get_sequence())} aa)")
# Calculate CA-CA distance
chain_a = model["A"]
ca1 = chain_a[10]["CA"]
ca2 = chain_a[20]["CA"]
distance = ca1 - ca2
print(f"CA distance (res 10-20): {distance:.2f} Angstrom")
from Bio.PDB import PDBParser, Superimposer
import numpy as np
# Structure superimposition (RMSD calculation)
parser = PDBParser(QUIET=True)
struct1 = parser.get_structure("s1", "structure1.pdb")
struct2 = parser.get_structure("s2", "structure2.pdb")
# Get CA atoms for alignment
atoms1 = [res["CA"] for res in struct1[0]["A"].get_residues() if "CA" in res]
atoms2 = [res["CA"] for res in struct2[0]["A"].get_residues() if "CA" in res]
# Superimpose (requires same number of atoms)
n = min(len(atoms1), len(atoms2))
sup = Superimposer()
sup.set_atoms(atoms1[:n], atoms2[:n])
sup.apply(struct2.get_atoms())
print(f"RMSD: {sup.rms:.3f} Angstrom over {n} CA atoms")
Module 7: Phylogenetics (Bio.Phylo)
Build, manipulate, and visualize phylogenetic trees.
from Bio import Phylo, AlignIO
from Bio.Phylo.TreeConstruction import DistanceCalculator, DistanceTreeConstructor
import io
# Build tree from multiple sequence alignment
alignment = AlignIO.read("aligned_sequences.fasta", "fasta")
print(f"Alignment: {len(alignment)} sequences, {alignment.get_alignment_length()} positions")
# Calculate distance matrix and build NJ tree
calculator = DistanceCalculator("identity")
dm = calculator.get_distance(alignment)
print(f"Distance matrix:\n{dm}")
constructor = DistanceTreeConstructor()
nj_tree = constructor.nj(dm)
upgma_tree = constructor.upgma(dm)
# Visualize
Phylo.draw_ascii(nj_tree)
# Save tree
Phylo.write(nj_tree, "tree.nwk", "newick")
print("Saved tree.nwk")
Module 8: Sequence Utilities (Bio.SeqUtils)
Compute sequence statistics and physicochemical properties.
from Bio.Seq import Seq
from Bio.SeqUtils import gc_fraction, molecular_weight, MeltingTemp
dna = Seq("ATCGATCGATCGATCGATCG")
print(f"GC content: {gc_fraction(dna):.2%}")
print(f"Molecular weight: {molecular_weight(dna, seq_type='DNA'):.2f} Da")
print(f"Melting temp (basic): {MeltingTemp.Tm_Wallace(dna):.1f} C")
print(f"Melting temp (NN): {MeltingTemp.Tm_NN(dna):.1f} C")
# Protein analysis
from Bio.SeqUtils.ProtParam import ProteinAnalysis
protein = ProteinAnalysis("MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTK")
print(f"\nProtein MW: {protein.molecular_weight():.2f} Da")
print(f"Isoelectric point: {protein.isoelectric_point():.2f}")
print(f"Aromaticity: {protein.aromaticity():.4f}")
print(f"Instability index: {protein.instability_index():.2f}")
print(f"GRAVY: {protein.gravy():.4f}")
aa_pct = protein.get_amino_acids_percent()
print(f"Top 3 amino acids: {sorted(aa_pct.items(), key=lambda x: -x[1])[:3]}")
Common Workflows
Workflow 1: Gene Sequence Retrieval and Analysis Pipeline
Goal: Fetch a gene from NCBI, analyze its properties, translate to protein, and compute statistics.
from Bio import Entrez, SeqIO
from Bio.Seq import Seq
from Bio.SeqUtils import gc_fraction
from Bio.SeqUtils.ProtParam import ProteinAnalysis
Entrez.email = "your.email@example.com"
# Step 1: Fetch gene from GenBank
handle = Entrez.efetch(db="nucleotide", id="NM_007294.4", rettype="gb", retmode="text")
record = SeqIO.read(handle, "genbank")
handle.close()
print(f"Gene: {record.description}")
print(f"Length: {len(record.seq)} bp")
# Step 2: Extract CDS
cds_features = [f for f in record.features if f.type == "CDS"]
if cds_features:
cds = cds_features[0]
cds_seq = cds.location.extract(record).seq
print(f"CDS: {len(cds_seq)} bp, GC: {gc_fraction(cds_seq):.2%}")
# Step 3: Translate
protein_seq = cds_seq.translate(to_stop=True)
print(f"Protein: {len(protein_seq)} aa")
print(f"First 30 aa: {protein_seq[:30]}...")
# Step 4: Protein properties
analysis = ProteinAnalysis(str(protein_seq))
print(f"MW: {analysis.molecular_weight():.0f} Da")
print(f"pI: {analysis.isoelectric_point():.2f}")
print(f"Instability: {analysis.instability_index():.1f}")
print(f"GRAVY: {analysis.gravy():.3f}")
Workflow 2: Comparative Sequence Analysis with BLAST and Phylogeny
Goal: BLAST a protein sequence, fetch homologs, align, and build a phylogenetic tree.
from Bio.Blast import NCBIWWW, NCBIXML
from Bio import Entrez, SeqIO, AlignIO, Phylo
from Bio.Phylo.TreeConstruction import DistanceCalculator, DistanceTreeConstructor
from Bio.Align.Applications import MuscleCommandline
import time
Entrez.email = "your.email@example.com"
# Step 1: BLAST search
query = "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
result_handle = NCBIWWW.qblast("blastp", "swissprot", query, hitlist_size=10)
blast_record = NCBIXML.read(result_handle)
print(f"BLAST hits: {len(blast_record.alignments)}")
# Step 2: Collect homolog accessions
accessions = []
for aln in blast_record.alignments[:8]:
acc = aln.accession
accessions.append(acc)
print(f" {acc}: E={aln.hsps[0].expect:.2e}, {aln.hit_def[:50]}...")
# Step 3: Fetch sequences and save for alignment
handle = Entrez.efetch(db="protein", id=",".join(accessions), rettype="fasta", retmode="text")
records = list(SeqIO.parse(handle, "fasta"))
handle.close()
SeqIO.write(records, "homologs.fasta", "fasta")
print(f"Saved {len(records)} homolog sequences")
# Step 4: Align (requires MUSCLE installed)
# muscle_cline = MuscleCommandline(input="homologs.fasta", out="aligned.fasta")
# muscle_cline()
# Step 5: Build phylogenetic tree from alignment
alignment = AlignIO.read("aligned.fasta", "fasta")
calculator = DistanceCalculator("blosum62")
dm = calculator.get_distance(alignment)
tree = DistanceTreeConstructor().nj(dm)
Phylo.draw_ascii(tree)
Phylo.write(tree, "homologs.nwk", "newick")
print("Saved phylogenetic tree to homologs.nwk")
Workflow 3: Batch Sequence Processing and Quality Filtering
Goal: Process a large FASTQ/FASTA dataset — filter by quality/length, compute statistics, and export.
from Bio import SeqIO
from Bio.SeqUtils import gc_fraction
import pandas as pd
# Step 1: Stream through large file and collect stats
stats = []
passed = []
for rec in SeqIO.parse("reads.fastq", "fastq"):
seq_len = len(rec.seq)
gc = gc_fraction(rec.seq)
avg_qual = sum(rec.letter_annotations["phred_quality"]) / seq_len
stats.append({"id": rec.id, "length": seq_len, "gc": gc, "avg_qual": avg_qual})
# Filter: length >= 100 and avg quality >= 20
if seq_len >= 100 and avg_qual >= 20:
passed.append(rec)
# Step 2: Summary statistics
df = pd.DataFrame(stats)
print(f"Total reads: {len(df)}")
print(f"Passed QC: {len(passed)} ({len(passed)/len(df)*100:.1f}%)")
print(f"\nLength: mean={df['length'].mean():.0f}, median={df['length'].median():.0f}")
print(f"GC: mean={df['gc'].mean():.2%}, std={df['gc'].std():.2%}")
print(f"Quality: mean={df['avg_qual'].mean():.1f}, min={df['avg_qual'].min():.1f}")
# Step 3: Export filtered reads
count = SeqIO.write(passed, "filtered_reads.fastq", "fastq")
print(f"\nExported {count} filtered reads to filtered_reads.fastq")
# Step 4: Save statistics
df.to_csv("read_statistics.csv", index=False)
print(f"Saved statistics to read_statistics.csv")
Key Parameters
| Parameter | Module | Default | Range / Options | Effect |
|---|---|---|---|---|
Seq.translate(table=) |
Bio.Seq | 1 (Standard) |
1-33 |
NCBI genetic code table for translation |
Seq.translate(to_stop=) |
Bio.Seq | False |
True, False |
Stop at first stop codon vs translate entire sequence |
SeqIO.parse(format=) |
Bio.SeqIO | — | "fasta", "genbank", "fastq", "phylip" |
File format for parsing |
Entrez.email |
Bio.Entrez | (required) | Valid email | NCBI requires email for tracking; set before any Entrez call |
Entrez.api_key |
Bio.Entrez | None |
NCBI API key string | Increases rate limit from 3 to 10 requests/second |
PairwiseAligner.mode |
Bio.Align | "global" |
"global", "local" |
Needleman-Wunsch vs Smith-Waterman algorithm |
PairwiseAligner.open_gap_score |
Bio.Align | -1 |
-20 to 0 |
Penalty for opening a gap; more negative = fewer gaps |
PairwiseAligner.substitution_matrix |
Bio.Align | None | "BLOSUM62", "BLOSUM45", "PAM250" |
Scoring matrix for protein alignment |
PDBParser(QUIET=) |
Bio.PDB | False |
True, False |
Suppress parser warnings for non-standard PDB files |
DistanceCalculator(model=) |
Bio.Phylo | "identity" |
"identity", "blosum62" |
Distance model for tree construction |
Common Recipes
Recipe: Restriction Enzyme Analysis
When to use: Find restriction sites in a DNA sequence for cloning design.
from Bio.Seq import Seq
from Bio.Restriction import EcoRI, BamHI, HindIII, RestrictionBatch, Analysis
seq = Seq("GAATTCAAAGGATCCTTTTAAGCTTGGGAATTC")
# Single enzyme
print(f"EcoRI cuts at: {EcoRI.search(seq)}")
print(f"BamHI cuts at: {BamHI.search(seq)}")
# Batch analysis
batch = RestrictionBatch([EcoRI, BamHI, HindIII])
analysis = Analysis(batch, seq)
result = analysis.full()
for enzyme, sites in result.items():
if sites:
print(f"{enzyme}: cuts at positions {sites}")
Recipe: Motif Discovery and Position Weight Matrix
When to use: Analyze transcription factor binding sites or consensus patterns.
from Bio import motifs
from Bio.Seq import Seq
# Create motif from observed binding sites
instances = [
Seq("TACGAT"),
Seq("TAGCAT"),
Seq("TACGGT"),
Seq("TAGCAT"),
Seq("TACGAT"),
]
m = motifs.create(instances)
print(f"Consensus: {m.consensus}")
print(f"Degenerate: {m.degenerate_consensus}")
print(f"\nPosition Weight Matrix:")
print(m.counts)
# Score a new sequence against the motif
pwm = m.counts.normalize(pseudocounts=0.5)
pssm = pwm.log_odds()
test_seq = Seq("AATACGATCCC")
for pos, score in pssm.search(test_seq, threshold=0.0):
print(f" Position {pos}: score={score:.2f}")
Recipe: GenomeDiagram — Visualize Genomic Features
When to use: Create a circular or linear genome map from a GenBank file.
from Bio import SeqIO
from Bio.Graphics import GenomeDiagram
from reportlab.lib import colors
from reportlab.lib.units import cm
# Load annotated genome
record = SeqIO.read("plasmid.gb", "genbank")
# Create diagram
diagram = GenomeDiagram.Diagram(record.name)
track = diagram.new_track(1, name="Annotated Features", greytrack=True)
feature_set = track.new_set()
# Color features by type
color_map = {"CDS": colors.blue, "gene": colors.green, "promoter": colors.red}
for feature in record.features:
if feature.type in color_map:
feature_set.add_feature(feature, color=color_map[feature.type], label=True, label_size=8)
# Draw circular map
diagram.draw(format="circular", circular=True, pagesize=(20*cm, 20*cm), start=0, end=len(record))
diagram.write("genome_map.pdf", "PDF")
print(f"Saved genome_map.pdf ({len(record.features)} features)")
Recipe: Batch PubMed Literature Search
When to use: Programmatically search and download publication metadata.
from Bio import Entrez
import time
Entrez.email = "your.email@example.com"
# Search PubMed with complex query
query = "(CRISPR[Title]) AND (2024[Date - Publication]) AND (review[Publication Type])"
handle = Entrez.esearch(db="pubmed", term=query, retmax=100)
results = Entrez.read(handle)
handle.close()
print(f"Found {results['Count']} articles")
# Fetch abstracts in batches
ids = results["IdList"]
batch_size = 20
articles = []
for i in range(0, len(ids), batch_size):
batch = ids[i:i+batch_size]
handle = Entrez.efetch(db="pubmed", id=",".join(batch), rettype="xml")
records = Entrez.read(handle)
handle.close()
for article in records["PubmedArticle"]:
info = article["MedlineCitation"]["Article"]
title = info.get("ArticleTitle", "N/A")
abstract = info.get("Abstract", {}).get("AbstractText", ["N/A"])[0]
articles.append({"title": title, "abstract": str(abstract)[:200]})
time.sleep(0.4) # Rate limiting
for a in articles[:5]:
print(f" {a['title'][:70]}...")
print(f"\nRetrieved {len(articles)} articles")
Troubleshooting
| Problem | Cause | Solution |
|---|---|---|
HTTPError 400 from Entrez |
Invalid accession/ID or malformed query | Validate accessions; check query syntax with NCBI web interface first |
HTTPError 429 (Too Many Requests) |
Exceeding NCBI rate limit (3 req/s) | Set Entrez.api_key for 10 req/s; add time.sleep(0.4) between calls |
ValueError: No records found in SeqIO.read() |
Empty file or wrong format string | Use SeqIO.parse() to check if file has records; verify format matches actual content |
Bio.PDB.PDBExceptions.PDBConstructionWarning |
Non-standard atoms or occupancy issues | Use PDBParser(QUIET=True) or fix PDB with pdb-tools; check for alternate conformations |
| BLAST search times out | Large query or busy NCBI servers | Use local BLAST+ for large-scale searches; set NCBIWWW.qblast(hitlist_size=N) to limit results |
Alignment has sequences of different lengths |
Unaligned sequences passed to AlignIO | Align sequences first with MUSCLE/Clustal before loading as alignment |
SeqIO.index() raises ValueError |
Duplicate IDs in FASTA file | Deduplicate IDs with SeqIO.to_dict() or pre-process with awk |
ImportError: No module named Bio |
Biopython not installed in active environment | pip install biopython; verify with python -c "import Bio; print(Bio.__version__)" |
translate() gives unexpected * |
Stop codons in middle of sequence | Check reading frame; use Seq.translate(table=N) with correct genetic code |
| GenomeDiagram blank output | No features matched filter criteria | Check feature.type values in your GenBank file; print types to debug |
References
- Biopython Tutorial and Cookbook — Official comprehensive tutorial
- Biopython API Documentation — Complete API reference
- Cock, P.J.A. et al. (2009) Bioinformatics 25:1422-1423 — Original Biopython paper
- NCBI Entrez Programming Utilities — E-utilities documentation for programmatic NCBI access
- Biopython GitHub Repository — Source code, issues, and release notes
版本历史
- 02745ef 当前 2026-07-19 09:17


