gget-genomic-databases
GitHubgget提供统一CLI/Python接口访问20+基因组数据库,支持基因查询、序列检索、BLAST、AlphaFold结构预测及疾病关联分析。
触发场景
安装
npx skills add jaechang-hits/SciAgent-Skills --skill gget-genomic-databases -g -y
SKILL.md
Frontmatter
{
"name": "gget-genomic-databases",
"license": "BSD-2-Clause",
"description": "Unified CLI\/Python interface to 20+ genomic databases. Gene lookups (Ensembl search\/info\/seq), BLAST\/BLAT, AlphaFold, Enrichr enrichment, OpenTargets disease\/drug, CELLxGENE single-cell, cBioPortal\/COSMIC cancer, ARCHS4 expression. Spans genomics, proteomics, disease. For batch\/advanced BLAST use biopython; for multi-DB Python SDK use bioservices."
}
gget — Unified Genomic Database Access
Overview
gget is a command-line and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequences, protein structures, expression data, and disease associations through a consistent interface. All modules work as both CLI tools and Python functions, returning DataFrames (Python) or JSON/CSV (CLI).
When to Use
- Looking up gene information (names, IDs, descriptions) across species from Ensembl
- Retrieving nucleotide or protein sequences for Ensembl gene/transcript IDs
- Running BLAST or BLAT searches against standard reference databases
- Predicting protein 3D structures with AlphaFold2 from amino acid sequences
- Performing gene set enrichment analysis (GO, KEGG, disease terms) via Enrichr
- Querying single-cell RNA-seq datasets from CELLxGENE Census
- Finding disease and drug associations for a gene target via OpenTargets
- Downloading Ensembl reference genomes and annotations for a species
- Finding cancer mutations and genomic alterations via cBioPortal or COSMIC
- Getting tissue expression and correlated genes from ARCHS4
- For batch processing or advanced BLAST parameters, use
biopythoninstead - For programmatic multi-database workflows with rate limiting, use
bioservicesinstead
Prerequisites
- Python packages:
gget - Optional setup: Some modules require
gget setup <module>before first use (alphafold, cellxgene, elm, gpt) - Environment: Clean virtual environment recommended to avoid dependency conflicts
- API notes: gget queries remote databases — rate-limit large batch queries with
time.sleep(). Databases update biweekly; keep gget updated. Max ~1000 Ensembl IDs pergget.info()call
pip install gget
# Optional: setup modules that need additional dependencies
gget setup alphafold # ~4GB model parameters, requires OpenMM
gget setup cellxgene # cellxgene-census package
gget setup elm # local ELM database
Quick Start
import gget
# Search for genes by keyword
results = gget.search(["BRCA1", "tumor suppressor"], species="homo_sapiens")
print(f"Found {len(results)} genes")
# Get detailed gene information (Ensembl + UniProt + NCBI)
info = gget.info(["ENSG00000012048"])
print(f"Gene: {info.iloc[0]['primary_gene_name']}")
# Enrichment analysis on a gene list
enrichment = gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology")
print(f"Enriched terms: {len(enrichment)}")
Core API
Module 1: Reference & Gene Search (ref, search, info, seq)
Query Ensembl for gene references, search by keywords, retrieve gene metadata, and fetch sequences.
import gget
# Search for genes by keyword
results = gget.search(["BRCA1", "tumor suppressor"], species="homo_sapiens")
print(f"Found {len(results)} genes")
print(results[["ensembl_id", "gene_name", "biotype"]].head())
# Get detailed gene information (Ensembl + UniProt + NCBI)
info = gget.info(["ENSG00000012048", "ENSG00000139618"])
print(f"Gene info columns: {list(info.columns)}")
import gget
# Retrieve sequences
nucleotide_seqs = gget.seq(["ENSG00000012048"])
protein_seqs = gget.seq(["ENSG00000012048"], translate=True, isoforms=True)
print(f"Retrieved {len(protein_seqs)} isoform sequences")
# Download reference genome files (specify release for reproducibility)
ref_links = gget.ref("homo_sapiens", which="gtf", release=112)
print(f"GTF download link: {ref_links}")
Module 2: Sequence Alignment (blast, blat, muscle, diamond)
BLAST/BLAT remote searches, multiple sequence alignment, and fast local alignment.
import gget
import time
# BLAST against SwissProt (remote API — add delay for batch queries)
blast_results = gget.blast(
"MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR",
database="swissprot", limit=10
)
print(f"Top hit: {blast_results.iloc[0]['Description']}, E-value: {blast_results.iloc[0]['e-value']}")
time.sleep(2) # Rate-limit between BLAST queries
# BLAT — find genomic position (UCSC)
blat_results = gget.blat("ATCGATCGATCGATCGATCG", assembly="human")
print(f"Genomic location: chr{blat_results.iloc[0]['chromosome']}:{blat_results.iloc[0]['start']}")
import gget
# Multiple sequence alignment with Muscle5
aligned = gget.muscle("sequences.fasta", save=True)
# Fast local alignment with DIAMOND (local, no rate limit needed)
diamond_results = gget.diamond(
"GGETISAWESQME",
reference="reference.fasta",
sensitivity="very-sensitive",
threads=4
)
print(f"Alignments found: {len(diamond_results)}")
Module 3: Protein Structure (pdb, alphafold, elm)
Download PDB structures, predict structures with AlphaFold2, find linear motifs.
import gget
# Download PDB structure
pdb_data = gget.pdb("7S7U", save=True)
# Predict structure with AlphaFold2 (requires gget setup alphafold)
structure = gget.alphafold(
"MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR",
plot=True, show_sidechains=True
)
print("Structure prediction complete, PDB file saved")
import gget
# Find Eukaryotic Linear Motifs (requires gget setup elm)
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
print(f"Ortholog motifs: {len(ortholog_df)}, Regex motifs: {len(regex_df)}")
Module 4: Expression & Correlation (archs4, cellxgene, bgee)
Gene expression, tissue expression, correlated genes, single-cell data.
import gget
# Tissue expression from ARCHS4
tissue_expr = gget.archs4("ACE2", which="tissue")
print(f"Expression across {len(tissue_expr)} tissues")
# Correlated genes from ARCHS4
correlated = gget.archs4("ACE2", which="correlation")
print(f"Top correlated gene: {correlated.iloc[0]['gene_symbol']}")
import gget
# Single-cell data from CELLxGENE (requires gget setup cellxgene)
adata = gget.cellxgene(
gene=["ACE2", "TMPRSS2"],
tissue="lung",
cell_type="epithelial cell",
census_version="2023-07-25" # pin version for reproducibility
)
print(f"Cells: {adata.n_obs}, Genes: {adata.n_vars}")
# Orthologs and expression from Bgee
orthologs = gget.bgee("ENSG00000169194", type="orthologs")
print(f"Orthologs in {len(orthologs)} species")
Module 5: Disease & Drug Associations (opentargets, enrichr)
Disease associations, drug targets, enrichment analysis.
import gget
# Disease associations from OpenTargets
diseases = gget.opentargets("ENSG00000169194", resource="diseases", limit=10)
print(f"Associated diseases: {len(diseases)}")
# Drug associations
drugs = gget.opentargets("ENSG00000169194", resource="drugs", limit=10)
print(f"Associated drugs: {len(drugs)}")
# OpenTargets resources: diseases, drugs, tractability, pharmacogenetics,
# expression, depmap, interactions
import gget
# Enrichment analysis via Enrichr
# Database shortcuts: 'pathway' (KEGG), 'transcription' (ChEA),
# 'ontology' (GO_BP), 'diseases_drugs' (GWAS), 'celltypes' (PanglaoDB)
enrichment = gget.enrichr(
["ACE2", "AGT", "AGTR1", "TMPRSS2", "DPP4"],
database="ontology"
)
print(f"Enriched terms: {len(enrichment)}")
print(enrichment[["Term", "Adjusted P-value"]].head())
Module 6: Cancer Genomics (cbio, cosmic)
Cancer mutations, copy number alterations, and somatic mutation databases.
import gget
# Search cBioPortal studies
studies = gget.cbio_search(["breast", "lung"])
print(f"Studies found: {len(studies)}")
# Plot cancer genomics heatmap
gget.cbio_plot(
["msk_impact_2017"],
["AKT1", "ALK", "BRAF"],
stratification="tissue",
variation_type="mutation_occurrences"
)
import gget
# COSMIC: requires account + local database download
# First-time: gget.cosmic(searchterm="", download_cosmic=True,
# email="user@example.com", password="xxx", cosmic_project="cancer")
cosmic_results = gget.cosmic("EGFR", cosmic_tsv_path="cosmic_data.tsv", limit=10)
print(f"COSMIC mutations: {len(cosmic_results)}")
Module 7: Mutation Generation & Utilities (mutate, setup)
Generate mutated sequences and manage module dependencies.
import gget
import pandas as pd
# Generate mutated sequences from mutation annotations
mutations_df = pd.DataFrame({
"seq_ID": ["seq1", "seq1"],
"mutation": ["c.4G>T", "c.10del"]
})
mutated = gget.mutate(["ATCGCTAAGCTGATCG"], mutations=mutations_df)
print(f"Generated {len(mutated)} mutated sequences")
Key Concepts
Module Overview
gget organizes 20+ modules by domain. Python interface uses gget.<module>():
| Domain | Modules | Primary Database |
|---|---|---|
| Gene reference | ref, search, info, seq |
Ensembl, UniProt, NCBI |
| Sequence alignment | blast, blat, muscle, diamond |
NCBI BLAST, UCSC, local |
| Protein structure | pdb, alphafold, elm |
RCSB PDB, AlphaFold2, ELM |
| Expression | archs4, cellxgene, bgee |
ARCHS4, CZ CELLxGENE, Bgee |
| Disease/drugs | opentargets, enrichr |
OpenTargets, Enrichr |
| Cancer | cbio, cosmic |
cBioPortal, COSMIC |
| Utilities | mutate, setup, gpt |
local / OpenAI |
Output Formats
| Context | Default Format | Alternatives |
|---|---|---|
| Python | DataFrame or dict | json=True for JSON; save=True to file |
| CLI | JSON | -csv for CSV; -o file to save |
| Sequences | FASTA (seq, mutate) | -- |
| Structures | PDB file (pdb, alphafold) | JSON alignment error data |
| Single-cell | AnnData object (cellxgene) | meta_only=True for metadata only |
| Visualization | PNG (cbio plot) | show=True for interactive display |
Enrichr Database Shortcuts
| Shortcut | Full Database Name |
|---|---|
'pathway' |
KEGG_2021_Human |
'transcription' |
ChEA_2016 |
'ontology' |
GO_Biological_Process_2021 |
'diseases_drugs' |
GWAS_Catalog_2019 |
'celltypes' |
PanglaoDB_Augmented_2021 |
Custom libraries: pass any Enrichr library name directly (e.g., "Jensen_TISSUES").
OpenTargets Resources
| Resource | Description |
|---|---|
diseases |
Disease associations with evidence scores |
drugs |
Drug associations and clinical trial data |
tractability |
Target tractability assessment |
pharmacogenetics |
Pharmacogenetic variants |
expression |
Baseline tissue expression |
depmap |
DepMap gene-disease effects |
interactions |
Protein-protein interactions |
Reproducibility
Pin database versions for consistent results across analyses:
import gget
# Pin Ensembl release
ref = gget.ref("homo_sapiens", release=112)
# Pin CELLxGENE Census version
adata = gget.cellxgene(gene=["ACE2"], census_version="2023-07-25")
# Always record gget version
print(f"gget version: {gget.__version__}")
Common Workflows
Workflow 1: Gene Discovery to Functional Analysis
Goal: Find genes of interest, get their sequences, and perform enrichment analysis.
import gget
# 1. Search for genes
results = gget.search(["GABA", "receptor"], species="homo_sapiens")
gene_ids = results["ensembl_id"].tolist()[:10]
# 2. Get detailed information
info = gget.info(gene_ids)
print(f"Retrieved info for {len(info)} genes")
# 3. Get protein sequences
sequences = gget.seq(gene_ids, translate=True)
# 4. Find correlated genes
correlated = gget.archs4(info.index[0], which="correlation")
# 5. Enrichment analysis on correlated genes
gene_list = correlated["gene_symbol"].tolist()[:50]
enrichment = gget.enrichr(gene_list, database="ontology")
print(f"Top enriched term: {enrichment.iloc[0]['Term']}")
Workflow 2: Target Validation for Drug Discovery
Goal: Investigate a gene's disease associations, druggability, and cancer mutations.
import gget
gene_id = "ENSG00000169194" # ZBTB16
# 1. Disease associations
diseases = gget.opentargets(gene_id, resource="diseases", limit=20)
# 2. Drug associations
drugs = gget.opentargets(gene_id, resource="drugs")
# 3. Tractability assessment
tractability = gget.opentargets(gene_id, resource="tractability")
# 4. Protein interactions
interactions = gget.opentargets(gene_id, resource="interactions")
print(f"Diseases: {len(diseases)}, Drugs: {len(drugs)}, Interactions: {len(interactions)}")
# 5. Cancer genomics
gget.cbio_plot(["msk_impact_2017"], ["ZBTB16"], stratification="cancer_type")
Workflow 3: Comparative Genomics
Goal: Compare a gene across species using orthologs and sequence alignment.
import gget
# 1. Find orthologs
orthologs = gget.bgee("ENSG00000169194", type="orthologs")
# 2. Get sequences for human and mouse
human_seq = gget.seq("ENSG00000169194", translate=True)
mouse_seq = gget.seq("ENSMUSG00000026091", translate=True)
# 3. Align sequences
alignment = gget.muscle([human_seq, mouse_seq])
# 4. Get human protein structure from PDB
pdb_structure = gget.pdb("7S7U")
print("Comparative analysis complete")
Key Parameters
| Parameter | Module(s) | Default | Range / Options | Effect |
|---|---|---|---|---|
species |
search, archs4, cellxgene, enrichr | "homo_sapiens" |
Any Ensembl species; shortcuts: 'human', 'mouse' | Target organism |
limit |
blast, opentargets, cosmic | 50 / 100 |
1-1000 |
Maximum results returned |
database |
blast, enrichr | varies | blast: nt/nr/swissprot/pdbaa; enrichr: shortcuts or library names | Target database for query |
which |
ref, archs4 | varies | ref: gtf,cdna,dna,cds,pep; archs4: correlation,tissue |
Data type to retrieve |
translate |
seq | False |
True/False |
Return amino acid instead of nucleotide sequences |
resource |
opentargets | "diseases" |
diseases, drugs, tractability, pharmacogenetics, expression, depmap, interactions | OpenTargets data type |
release |
ref, search | latest | Integer Ensembl release number | Pin database version for reproducibility |
census_version |
cellxgene | "stable" |
"stable", "latest", date string |
Pin CELLxGENE Census version |
sensitivity |
diamond, elm | "very-sensitive" |
fast to ultra-sensitive |
Alignment sensitivity vs speed |
threads |
diamond, elm | 1 |
1-N |
CPU threads for alignment |
multimer_recycles |
alphafold | 3 |
3-20 |
Higher = more accurate multimer prediction |
Best Practices
-
Pin database versions for reproducibility: Use
release=112for Ensembl andcensus_version="2023-07-25"for CELLxGENE to ensure consistent results across analyses. -
Rate-limit batch queries: gget queries remote APIs. Add
time.sleep(2)between BLAST/BLAT queries in loops. Forgget.info(), limit to ~1000 IDs per call. -
Keep gget updated: Databases change their structure biweekly. Run
pip install --upgrade ggetregularly to avoid breakage from schema changes. -
Use Python interface for pipelines, CLI for exploration: Python functions return DataFrames suitable for chaining. CLI with
-csvis better for quick one-off lookups. -
Check PDB before running AlphaFold:
gget.pdb()is instant; AlphaFold prediction takes minutes to hours. Always check if the structure already exists in PDB. -
Use database shortcuts in enrichr: The shortcuts (
'pathway','ontology', etc.) map to curated Enrichr libraries. For custom analyses, pass any Enrichr library name directly. -
Cache cBioPortal data for repeated analyses: Use
data_dir="./cache"parameter to avoid re-downloading large cancer genomics datasets.
Common Recipes
Recipe: Batch Gene Information Retrieval
When to use: Need information for many genes at once (up to ~1000 IDs per call).
import gget
import time
gene_ids = ["ENSG00000012048", "ENSG00000139618", "ENSG00000141510"]
info = gget.info(gene_ids)
info.to_csv("gene_info_batch.csv")
print(f"Saved info for {len(info)} genes")
# For >1000 genes, batch with rate limiting
all_ids = [f"ENSG{i:011d}" for i in range(2000)]
results = []
for i in range(0, len(all_ids), 500):
batch = all_ids[i:i+500]
results.append(gget.info(batch))
time.sleep(1)
Recipe: Custom Enrichment with Background
When to use: Running enrichment against a custom background gene set.
import gget
# Use specific Enrichr library with background genes
enrichment = gget.enrichr(
["ACE2", "AGT", "AGTR1"],
database="Jensen_TISSUES",
background_list=["ACE2", "AGT", "AGTR1", "TP53", "BRCA1", "MYC"]
)
print(enrichment[["Term", "Adjusted P-value"]].head())
Recipe: AlphaFold Structure Prediction with Visualization
When to use: Predicting and visualizing protein structures with confidence coloring.
import gget
# Predict with visualization (PAE + 3D structure)
result = gget.alphafold(
"MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR",
plot=True,
show_sidechains=True,
relax=True # AMBER relaxation for final structure
)
# Output: PDB file + predicted aligned error (PAE) JSON
# PAE heatmap auto-generated with plot=True
Recipe: Download Reference Genome for RNA-seq Pipeline
When to use: Setting up reference files for RNA-seq alignment pipelines.
# Download GTF and cDNA for human (specific release)
gget ref -w gtf -w cdna -d -r 112 homo_sapiens
# Download genome DNA
gget ref -w dna -d homo_sapiens
Troubleshooting
| Problem | Cause | Solution |
|---|---|---|
ModuleNotFoundError: gget |
Package not installed | pip install gget in clean virtual environment |
gget setup alphafold fails |
Python version incompatibility | Use Python 3.8-3.10; check gget --version |
| Empty BLAST results | Sequence too short or no matches | Try longer sequence, different database, or megablast_off=True |
cellxgene gene not found |
Case-sensitive gene symbols | Use 'ACE2' for human, 'Ace2' for mouse (exact capitalization required) |
gget info timeout |
Too many IDs at once | Limit to ~1000 Ensembl IDs per call; batch with time.sleep() |
| Database structure changed | gget databases update biweekly | pip install --upgrade gget |
| COSMIC authentication error | Missing or expired credentials | Re-enter email/password; check COSMIC account status |
| AlphaFold out of memory | Protein too long for GPU memory | Use shorter sequences or split into domains |
| Different results on re-run | Database updated between runs | Pin versions: release=112 for Ensembl, census_version for CELLxGENE |
Bundled Resources
2 reference files provide extended coverage of capabilities from the original 3 reference files and 3 script files:
-
references/module_parameters.md— Consolidates module_reference.md (468 lines). Covers: detailed parameter tables for all 15+ modules with types, defaults, and return value descriptions; CLI vs Python interface differences; setup requirements per module. Relocated inline: most-used module parameters (Core API code blocks), output format summary (Key Concepts table). Omitted: gget gpt module details — trivial OpenAI wrapper, not genomics-specific. -
references/databases_workflows.md— Consolidates database_info.md (301 lines) and workflows.md (815 lines). Covers: complete database directory with update frequencies and citation info, extended workflow examples (building reference indices, disease-drug pipeline, multi-species comparative analysis), data consistency and reproducibility guidance. Relocated inline: core database overview (Key Concepts table), top 3 workflows (Common Workflows), reproducibility patterns (Key Concepts). Omitted: scripts/ content (3 files, 590 lines total) — thin wrappers around gget API calls for CLI automation; core patterns absorbed into Core API and Common Workflows.
Related Skills
- biopython — advanced BLAST parameters, batch sequence processing, GenBank record parsing
- bioservices — programmatic multi-database queries with built-in rate limiting (UniProt, KEGG, ChEMBL)
- anndata-data-structure — working with AnnData objects returned by
gget.cellxgene() - enrichr — deeper enrichment analysis with custom gene set libraries
References
- gget documentation — official docs and tutorials
- gget GitHub — source code, issues
- Luebbert, L. & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836
版本历史
- 02745ef 当前 2026-07-19 09:18


