synthetic-biology
GitHub提供合成生物学设计与仿真工具,涵盖密码子优化、基因回路ODE建模、SBML模型创建、双稳态分析及条形码测序数据分析等,辅助实验设计。
Trigger Scenarios
Install
npx skills add synthetic-sciences/openscience --skill synthetic-biology -g -y
SKILL.md
Frontmatter
{
"name": "synthetic-biology",
"license": "MIT license",
"category": "biology",
"metadata": {
"skill-author": "InkVell Inc."
},
"description": "Synthetic biology design and simulation tools. Codon optimization, gene circuit ODE modeling with growth feedback, SBML model creation, bifurcation analysis, barcode sequencing fitness analysis, and therapeutic genome engineering. For metabolic modeling use cobrapy; for sequence tools use biopython."
}
Synthetic Biology: Design & Simulation
Overview
Synthetic Biology provides computational tools for designing and simulating engineered biological systems. This skill covers codon optimization with species-specific usage tables, gene circuit ODE modeling (repressilator, toggle switch, inducible promoters) with growth dilution coupling, SBML model creation and validation using python-libsbml, bifurcation analysis for bistable circuits, barcode sequencing fitness analysis, and genome engineering with expression cassette insertion. All simulations produce quantitative outputs suitable for guiding experimental design.
When to Use This Skill
- Optimizing gene sequences for heterologous expression (codon adaptation)
- Simulating gene circuit dynamics (toggle switches, repressilators, inducible systems)
- Creating standardized SBML models of biological networks
- Analyzing bistability and bifurcation behavior in synthetic circuits
- Processing barcode sequencing data for fitness landscape analysis
- Designing expression cassettes and generating annotated plasmid maps
- Sensitivity analysis of circuit parameters for robust design
Related Skills: For constraint-based metabolic modeling use cobrapy. For sequence manipulation and file parsing use biopython. For molecular cloning simulation use molecular-cloning.
Installation
uv pip install python-libsbml scipy biopython numpy pandas matplotlib
Quick Start
import numpy as np
from scipy.integrate import solve_ivp
# Toggle switch: two mutually repressing genes
def toggle_switch(t, y, alpha1, alpha2, beta, n, gamma):
u, v = y # Protein concentrations
du = alpha1 / (1 + v**n) - (beta + gamma) * u # gamma = growth dilution
dv = alpha2 / (1 + u**n) - (beta + gamma) * v
return [du, dv]
sol = solve_ivp(toggle_switch, [0, 50], [0.1, 3.0],
args=(5.0, 5.0, 0.5, 2.0, 0.1),
t_eval=np.linspace(0, 50, 500))
print(f"Final state: u={sol.y[0,-1]:.3f}, v={sol.y[1,-1]:.3f}")
print(f"Bistable: {'Yes' if abs(sol.y[0,-1] - sol.y[1,-1]) > 0.5 else 'No'}")
Core Capabilities
1. Codon Optimization
Optimize gene sequences for expression in target organisms.
import numpy as np
from collections import Counter
# E. coli codon usage table (fraction per amino acid)
ECOLI_CODON_TABLE = {
'F': {'TTT': 0.58, 'TTC': 0.42},
'L': {'TTA': 0.11, 'TTG': 0.11, 'CTT': 0.10, 'CTC': 0.10, 'CTA': 0.04, 'CTG': 0.54},
'I': {'ATT': 0.49, 'ATC': 0.39, 'ATA': 0.07},
'M': {'ATG': 1.0},
'V': {'GTT': 0.28, 'GTC': 0.20, 'GTA': 0.17, 'GTG': 0.35},
'S': {'TCT': 0.17, 'TCC': 0.15, 'TCA': 0.14, 'TCG': 0.14, 'AGT': 0.16, 'AGC': 0.25},
'P': {'CCT': 0.18, 'CCC': 0.13, 'CCA': 0.20, 'CCG': 0.49},
'T': {'ACT': 0.19, 'ACC': 0.40, 'ACA': 0.17, 'ACG': 0.25},
'A': {'GCT': 0.18, 'GCC': 0.26, 'GCA': 0.23, 'GCG': 0.33},
'Y': {'TAT': 0.59, 'TAC': 0.41},
'*': {'TAA': 0.61, 'TAG': 0.09, 'TGA': 0.30},
'H': {'CAT': 0.57, 'CAC': 0.43},
'Q': {'CAA': 0.34, 'CAG': 0.66},
'N': {'AAT': 0.49, 'AAC': 0.51},
'K': {'AAA': 0.74, 'AAG': 0.26},
'D': {'GAT': 0.63, 'GAC': 0.37},
'E': {'GAA': 0.68, 'GAG': 0.32},
'C': {'TGT': 0.46, 'TGC': 0.54},
'W': {'TGG': 1.0},
'R': {'CGT': 0.36, 'CGC': 0.36, 'CGA': 0.07, 'CGG': 0.11, 'AGA': 0.07, 'AGG': 0.04},
'G': {'GGT': 0.35, 'GGC': 0.37, 'GGA': 0.13, 'GGG': 0.15},
}
CODON_TO_AA = {}
for aa, codons in ECOLI_CODON_TABLE.items():
for codon in codons:
CODON_TO_AA[codon] = aa
def calculate_cai(dna_seq, codon_table=ECOLI_CODON_TABLE):
"""Calculate Codon Adaptation Index."""
codons = [dna_seq[i:i+3] for i in range(0, len(dna_seq)-2, 3)]
weights = []
for codon in codons:
aa = CODON_TO_AA.get(codon)
if aa and aa != '*':
aa_codons = codon_table[aa]
max_freq = max(aa_codons.values())
w = aa_codons.get(codon, 0) / max_freq if max_freq > 0 else 0
if w > 0:
weights.append(np.log(w))
cai = np.exp(np.mean(weights)) if weights else 0
return cai
def optimize_codons(protein_seq, codon_table=ECOLI_CODON_TABLE,
gc_min=0.40, gc_max=0.60):
"""Optimize codons for target organism."""
optimized = []
for aa in protein_seq:
if aa == '*':
break
if aa not in codon_table:
raise ValueError(f"Unknown amino acid: {aa}")
codons = codon_table[aa]
# Select highest-frequency codon
best_codon = max(codons, key=codons.get)
optimized.append(best_codon)
dna_seq = ''.join(optimized)
# Check GC content
gc = (dna_seq.count('G') + dna_seq.count('C')) / len(dna_seq)
cai = calculate_cai(dna_seq, codon_table)
print(f"Optimized sequence: {len(dna_seq)} bp")
print(f"GC content: {gc:.1%}")
print(f"CAI: {cai:.4f}")
if gc < gc_min or gc > gc_max:
print(f"WARNING: GC content {gc:.1%} outside target range [{gc_min:.0%}-{gc_max:.0%}]")
return dna_seq, cai, gc
# Example
protein = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL" # GFP fragment
opt_dna, cai, gc = optimize_codons(protein)
2. Gene Circuit Simulation
ODE models for common synthetic gene circuits.
import numpy as np
from scipy.integrate import solve_ivp
def repressilator(t, y, alpha, n, beta, gamma):
"""Repressilator: 3-gene oscillator (Elowitz & Leibler).
gamma = growth dilution rate."""
m1, p1, m2, p2, m3, p3 = y
dm1 = alpha / (1 + p3**n) - (beta + gamma) * m1
dp1 = m1 - (beta + gamma) * p1
dm2 = alpha / (1 + p1**n) - (beta + gamma) * m2
dp2 = m2 - (beta + gamma) * p2
dm3 = alpha / (1 + p2**n) - (beta + gamma) * m3
dp3 = m3 - (beta + gamma) * p3
return [dm1, dp1, dm2, dp2, dm3, dp3]
def inducible_promoter(t, y, V_max, Km, n, beta, gamma, inducer_conc):
"""Inducible gene expression (Hill function)."""
mRNA, protein = y
induction = V_max * inducer_conc**n / (Km**n + inducer_conc**n)
dmRNA = induction - (beta + gamma) * mRNA
dprotein = mRNA - (beta + gamma) * protein
return [dmRNA, dprotein]
# Simulate repressilator
y0 = [0.5, 1.0, 0.0, 0.0, 0.0, 0.0]
sol = solve_ivp(repressilator, [0, 200], y0,
args=(5.0, 2.0, 0.5, 0.1),
t_eval=np.linspace(0, 200, 2000),
method='RK45')
# Check for oscillation
from scipy.signal import find_peaks
peaks, _ = find_peaks(sol.y[1])
if len(peaks) > 2:
period = np.mean(np.diff(sol.t[peaks]))
print(f"Oscillation period: {period:.1f} time units")
print(f"Amplitude: {sol.y[1, peaks].mean() - sol.y[1].min():.3f}")
else:
print("No sustained oscillations detected")
# Parameter sensitivity analysis
def sensitivity_analysis(param_name, param_values, base_params, y0, t_span):
"""Sweep one parameter and measure output."""
results = []
for val in param_values:
params = base_params.copy()
params[param_name] = val
sol = solve_ivp(repressilator, t_span, y0,
args=tuple(params.values()),
t_eval=np.linspace(*t_span, 500))
# Measure amplitude
amplitude = sol.y[1].max() - sol.y[1].min()
results.append({'param_value': val, 'amplitude': amplitude})
return pd.DataFrame(results)
3. SBML Model Creation
Build standardized SBML models with python-libsbml.
import libsbml
def create_sbml_model(model_name, compartments, species_list, reactions):
"""Create SBML Level 3 model.
Args:
model_name: string name
compartments: list of (id, size) tuples
species_list: list of (id, compartment, initial_amount) tuples
reactions: list of dicts with 'id', 'reactants', 'products', 'kinetic_law'
"""
doc = libsbml.SBMLDocument(3, 2)
model = doc.createModel()
model.setId(model_name)
# Compartments
for comp_id, size in compartments:
c = model.createCompartment()
c.setId(comp_id)
c.setConstant(True)
c.setSize(size)
c.setSpatialDimensions(3)
# Species
for sp_id, comp_id, init_amount in species_list:
s = model.createSpecies()
s.setId(sp_id)
s.setCompartment(comp_id)
s.setInitialAmount(init_amount)
s.setConstant(False)
s.setBoundaryCondition(False)
s.setHasOnlySubstanceUnits(False)
# Reactions
for rxn in reactions:
r = model.createReaction()
r.setId(rxn['id'])
r.setReversible(rxn.get('reversible', False))
for reactant_id, stoich in rxn.get('reactants', []):
sr = r.createReactant()
sr.setSpecies(reactant_id)
sr.setStoichiometry(stoich)
sr.setConstant(True)
for product_id, stoich in rxn.get('products', []):
sp = r.createProduct()
sp.setSpecies(product_id)
sp.setStoichiometry(stoich)
sp.setConstant(True)
kl = r.createKineticLaw()
kl.setMath(libsbml.parseL3Formula(rxn['kinetic_law']))
# Add parameters
for param_id, value in rxn.get('parameters', []):
p = kl.createLocalParameter()
p.setId(param_id)
p.setValue(value)
# Validate
errors = doc.getNumErrors()
if errors > 0:
for i in range(errors):
print(f"SBML Error: {doc.getError(i).getMessage()}")
return doc
# Example: simple enzymatic reaction
doc = create_sbml_model(
'enzyme_kinetics',
compartments=[('cell', 1.0)],
species_list=[('S', 'cell', 10.0), ('P', 'cell', 0.0), ('E', 'cell', 1.0)],
reactions=[{
'id': 'v1',
'reactants': [('S', 1)],
'products': [('P', 1)],
'kinetic_law': 'Vmax * S / (Km + S)',
'parameters': [('Vmax', 1.0), ('Km', 0.5)]
}]
)
# Write to file
libsbml.writeSBMLToFile(doc, 'model.xml')
print("SBML model written to model.xml")
4. Bifurcation Analysis
Identify bistability in gene circuits.
import numpy as np
from scipy.optimize import fsolve
def toggle_steady_states(alpha1, alpha2, n, beta):
"""Find steady states of toggle switch by sweeping inducer."""
def steady_state_eq(x, alpha1_eff, alpha2, n, beta):
u, v = x
eq1 = alpha1_eff / (1 + v**n) - beta * u
eq2 = alpha2 / (1 + u**n) - beta * v
return [eq1, eq2]
inducer_values = np.linspace(0, 10, 200)
stable_u = []
stable_v = []
for ind in inducer_values:
alpha1_eff = alpha1 * (1 + ind) # Inducer enhances gene 1 expression
solutions = []
# Try multiple initial conditions to find all steady states
for u0 in [0.01, 1.0, 5.0, 10.0]:
for v0 in [0.01, 1.0, 5.0, 10.0]:
try:
sol = fsolve(steady_state_eq, [u0, v0],
args=(alpha1_eff, alpha2, n, beta),
full_output=True)
if sol[2] == 1: # Converged
u, v = sol[0]
if u > 0 and v > 0:
solutions.append((round(u, 4), round(v, 4)))
except Exception:
pass
# Deduplicate
unique = list(set(solutions))
for u, v in unique:
stable_u.append({'inducer': ind, 'u': u, 'branch': 'high' if u > v else 'low'})
import pandas as pd
df = pd.DataFrame(stable_u)
n_branches = df.groupby('inducer')['branch'].nunique()
bistable_range = n_branches[n_branches > 1]
if len(bistable_range) > 0:
print(f"Bistable region: inducer = [{bistable_range.index.min():.2f}, "
f"{bistable_range.index.max():.2f}]")
else:
print("No bistability detected")
return df
results = toggle_steady_states(alpha1=3.0, alpha2=3.0, n=2.5, beta=1.0)
5. Barcode Sequencing Analysis
Analyze fitness from barcode tracking experiments.
import pandas as pd
import numpy as np
from scipy.cluster.hierarchy import linkage, fcluster
def analyze_barcode_fitness(count_table, reference_timepoint='T0', min_reads=10):
"""Calculate fitness from barcode count data.
Args:
count_table: DataFrame with barcodes as index, timepoints as columns
reference_timepoint: column name for initial counts
"""
# Filter low-abundance barcodes
mask = count_table[reference_timepoint] >= min_reads
filtered = count_table[mask].copy()
print(f"Barcodes passing filter: {len(filtered)} / {len(count_table)}")
# Normalize to relative frequency
normalized = filtered.div(filtered.sum(axis=0), axis=1)
# Calculate log2 fold change vs reference
fitness = np.log2(normalized.div(normalized[reference_timepoint], axis=0) + 1e-10)
fitness = fitness.drop(columns=[reference_timepoint])
# Summary statistics
for col in fitness.columns:
positive = (fitness[col] > 0).sum()
negative = (fitness[col] < 0).sum()
print(f"{col}: {positive} positive, {negative} negative fitness barcodes")
return fitness
def cluster_lineage_fitness(fitness_df, n_clusters=5):
"""Hierarchical clustering of barcode fitness profiles."""
Z = linkage(fitness_df.values, method='ward')
clusters = fcluster(Z, n_clusters, criterion='maxclust')
fitness_df['cluster'] = clusters
# Cluster summary
for c in range(1, n_clusters+1):
cluster_data = fitness_df[fitness_df['cluster'] == c].drop(columns=['cluster'])
print(f"Cluster {c} ({len(cluster_data)} barcodes): "
f"mean fitness = {cluster_data.values.mean():.3f}")
return fitness_df
6. Genome Engineering
Design and annotate expression cassettes.
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.SeqFeature import SeqFeature, FeatureLocation
from Bio import SeqIO
def insert_expression_cassette(genome_record, insert_seq, locus_position,
promoter_name='Ptac', gene_name='gfp',
terminator_name='T7_term'):
"""Insert expression cassette at specified genomic locus."""
# Build cassette
cassette_features = []
pos = 0
# Promoter (assume 100bp)
promoter_seq = 'A' * 100 # Placeholder — use actual sequence
cassette_features.append(SeqFeature(
FeatureLocation(pos, pos + len(promoter_seq)),
type='promoter', qualifiers={'label': promoter_name}
))
pos += len(promoter_seq)
# RBS (20bp)
rbs_seq = 'AAGGAGATATACAT' # Consensus RBS
cassette_features.append(SeqFeature(
FeatureLocation(pos, pos + len(rbs_seq)),
type='RBS', qualifiers={'label': 'RBS'}
))
pos += len(rbs_seq)
# CDS
cassette_features.append(SeqFeature(
FeatureLocation(pos, pos + len(insert_seq)),
type='CDS', qualifiers={'label': gene_name, 'translation': str(Seq(insert_seq).translate())}
))
pos += len(insert_seq)
# Terminator (50bp)
term_seq = 'T' * 50
cassette_features.append(SeqFeature(
FeatureLocation(pos, pos + len(term_seq)),
type='terminator', qualifiers={'label': terminator_name}
))
full_cassette = promoter_seq + rbs_seq + insert_seq + term_seq
# Insert into genome
new_seq = str(genome_record.seq[:locus_position]) + full_cassette + \
str(genome_record.seq[locus_position:])
# Adjust feature positions
offset = len(full_cassette)
new_features = []
for f in genome_record.features:
if f.location.start >= locus_position:
new_loc = FeatureLocation(f.location.start + offset,
f.location.end + offset, f.location.strand)
new_features.append(SeqFeature(new_loc, type=f.type, qualifiers=f.qualifiers))
else:
new_features.append(f)
# Add cassette features
for f in cassette_features:
adjusted = SeqFeature(
FeatureLocation(f.location.start + locus_position,
f.location.end + locus_position),
type=f.type, qualifiers=f.qualifiers
)
new_features.append(adjusted)
new_record = SeqRecord(Seq(new_seq), id=genome_record.id,
name=genome_record.name,
description=f"{genome_record.description} + {gene_name} cassette",
features=new_features)
return new_record
Typical Workflows
Workflow 1: Optimize Gene for E. coli Expression and Calculate CAI
protein_seq = "MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK"
opt_dna, cai, gc = optimize_codons(protein_seq)
print(f"Original CAI: {calculate_cai(opt_dna):.4f}")
Workflow 2: Simulate Toggle Switch with Growth Dilution
import numpy as np
from scipy.integrate import solve_ivp
sol = solve_ivp(toggle_switch, [0, 100], [0.1, 3.0],
args=(5.0, 5.0, 0.5, 2.0, 0.1),
t_eval=np.linspace(0, 100, 1000))
print(f"Final: u={sol.y[0,-1]:.3f}, v={sol.y[1,-1]:.3f}")
print(f"State: {'Gene 1 ON' if sol.y[0,-1] > sol.y[1,-1] else 'Gene 2 ON'}")
Workflow 3: Create SBML Model of a Metabolic Pathway
doc = create_sbml_model(
'glycolysis_simplified',
compartments=[('cytoplasm', 1.0)],
species_list=[
('glucose', 'cytoplasm', 5.0),
('G6P', 'cytoplasm', 0.0),
('pyruvate', 'cytoplasm', 0.0),
('ATP', 'cytoplasm', 2.0),
],
reactions=[
{'id': 'hexokinase', 'reactants': [('glucose', 1), ('ATP', 1)],
'products': [('G6P', 1)], 'kinetic_law': 'Vmax * glucose * ATP / ((Km_g + glucose) * (Km_a + ATP))',
'parameters': [('Vmax', 1.0), ('Km_g', 0.1), ('Km_a', 0.5)]},
{'id': 'glycolysis', 'reactants': [('G6P', 1)],
'products': [('pyruvate', 2), ('ATP', 2)], 'kinetic_law': 'k * G6P',
'parameters': [('k', 0.5)]},
]
)
libsbml.writeSBMLToFile(doc, 'glycolysis.xml')
Best Practices
- Codon optimization — always check GC content after optimization; extreme GC can cause expression problems
- Circuit simulation — include growth dilution term (gamma * x) in all ODE models; cells divide, diluting intracellular molecules
- SBML validation — always call
doc.getNumErrors()after model creation; common errors are missing units and unbalanced reactions - Bifurcation analysis — use multiple initial conditions to find all steady states; bistable systems have hysteresis
- Barcode fitness — require minimum read count (>10) to filter PCR/sequencing noise; use log2 fold change for fitness
- Stiffness — gene circuits with fast mRNA and slow protein dynamics are stiff; use
method='BDF'insolve_ivp
Troubleshooting
Problem: ODE solver fails with "excess work"
Solution: Increase max_step or switch to stiff solver (BDF, Radau). Check parameter values for unreasonably large rates.
Problem: python-libsbml not found after installation
Solution: Use pip install python-libsbml (not libsbml). On some systems: pip install python-libsbml-experimental.
Problem: Codon optimization produces sequence with internal stop codons Solution: Verify protein sequence uses standard single-letter amino acid codes. Check for ambiguous residues (B, X, Z).
Problem: Bifurcation analysis misses steady states
Solution: Use more initial conditions for fsolve. Add parameter continuation methods for systematic sweeps.
Resources
Version History
- e9844a4 Current 2026-07-11 17:21


